DBI (Human) Recombinant Protein (Q01) Ver mas grande

Human DBI partial ORF ( NP_065438, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00001622-Q01

Producto nuevo

DBI (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name DBI
Gene Alias ACBD1|ACBP|CCK-RP|EP|MGC70414
Gene Description diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 1622

Más información

Human DBI partial ORF ( NP_065438, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human DBI partial ORF ( NP_065438, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.

Human DBI partial ORF ( NP_065438, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.