> >>>Human CUX1 full-length ORF ( AAH25422.1, 1 a.a. - 676 a.a.) recombinant protein with GST-tag at N-terminal.
CUX1 (Human) Recombinant Protein (P01) Ver mas grande

Human CUX1 full-length ORF ( AAH25422.1, 1 a.a. - 676 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00001523-P01

Producto nuevo

CUX1 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name CUX1
Gene Alias CASP|CDP|CDP/Cut|CDP1|COY1|CUTL1|CUX|Clox|Cux/CDP|GOLIM6|Nbla10317|p100|p110|p200|p75
Gene Description cut-like homeobox 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MAANVGSMFQYWKRFDLQQLQRELDATATVLANRQDESEQSRKRLIEQSREFKKNTPEDLRKQVAPLLKSFQGEIDALSKRSKEAEAAFLNVYKRLIDVPDPVPALDLGQQLQLKVQRLHDIETENQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQSLQTALEKTRTELFDLKTKYDEETTAKADEIEMIMTDLERANQRAE
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 1523

Más información

Human CUX1 full-length ORF ( AAH25422.1, 1 a.a. - 676 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human CUX1 full-length ORF ( AAH25422.1, 1 a.a. - 676 a.a.) recombinant protein with GST-tag at N-terminal.

Human CUX1 full-length ORF ( AAH25422.1, 1 a.a. - 676 a.a.) recombinant protein with GST-tag at N-terminal.