AB-H00000958-G01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Size | 2 ug |
Gene Name | CD40 |
Gene Alias | Bp50|CDW40|MGC9013|TNFRSF5|p50 |
Gene Description | CD40 molecule, TNF receptor superfamily member 5 |
Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Application Key | AP |
Immunogen Prot. Seq | MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETL |
Form | Liquid |
Recomended Dilution | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Antigen species Target species | Human |
Storage Buffer | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene ID | 958 |