> >>>Human SCARB1 full-length ORF ( Q8WTV0, 1 a.a. - 552 a.a.) recombinant protein with GST-tag at N-terminal.
SCARB1 (Human) Recombinant Protein (P01) Ver mas grande

Human SCARB1 full-length ORF ( Q8WTV0, 1 a.a. - 552 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00000949-P01

Producto nuevo

SCARB1 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 2 ug
Gene Name SCARB1
Gene Alias CD36L1|CLA-1|CLA1|MGC138242|SR-BI|SRB1
Gene Description scavenger receptor class B, member 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMIN
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 949

Más información

Human SCARB1 full-length ORF ( Q8WTV0, 1 a.a. - 552 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human SCARB1 full-length ORF ( Q8WTV0, 1 a.a. - 552 a.a.) recombinant protein with GST-tag at N-terminal.

Human SCARB1 full-length ORF ( Q8WTV0, 1 a.a. - 552 a.a.) recombinant protein with GST-tag at N-terminal.