> >>>Human ADORA2A full-length ORF ( NP_000666.2, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.
ADORA2A (Human) Recombinant Protein (P02) Ver mas grande

Human ADORA2A full-length ORF ( NP_000666.2, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00000135-P02

Producto nuevo

ADORA2A (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 2 ug
Gene Name ADORA2A
Gene Alias ADORA2|RDC8|hA2aR
Gene Description adenosine A2a receptor
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCF
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 135

Más información

Human ADORA2A full-length ORF ( NP_000666.2, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human ADORA2A full-length ORF ( NP_000666.2, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.

Human ADORA2A full-length ORF ( NP_000666.2, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.