> >>>Human ADARB1 full-length ORF ( NP_056648.1, 1 a.a. - 741 a.a.) recombinant protein with GST-tag at N-terminal.
ADARB1 (Human) Recombinant Protein (P01) Ver mas grande

Human ADARB1 full-length ORF ( NP_056648.1, 1 a.a. - 741 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00000104-P01

Producto nuevo

ADARB1 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name ADARB1
Gene Alias ADAR2|ADAR2a|ADAR2a-L1|ADAR2a-L2|ADAR2a-L3|ADAR2b|ADAR2c|ADAR2d|ADAR2g|DRABA2|DRADA2|RED1
Gene Description adenosine deaminase, RNA-specific, B1 (RED1 homolog rat)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSES
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 104

Más información

Human ADARB1 full-length ORF ( NP_056648.1, 1 a.a. - 741 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human ADARB1 full-length ORF ( NP_056648.1, 1 a.a. - 741 a.a.) recombinant protein with GST-tag at N-terminal.

Human ADARB1 full-length ORF ( NP_056648.1, 1 a.a. - 741 a.a.) recombinant protein with GST-tag at N-terminal.