Ver mas grande
Anti-RASEF Antibody 25ul
AN-HPA078596-25ul
Producto nuevo
Anti-RASEF
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 25ul |
| Gene Name | RASEF |
| Gene Description | RAS and EF-hand domain containing |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | IHC |
| Sequence | GLSTLRDPNEYDSEVEYKHQRGFQRSHGVQESFGGDASDTDVPDIRDEETFGLEDVASVLDWKPQGSVSEGSIVSSSRKPISAL |
| Immunogen | GLSTLRDPNEYDSEVEYKHQRGFQRSHGVQESFGGDASDTDVPDIRDEETFGLEDVASVLDWKPQGSVSEGSIVSSSRKPISAL |
| Product Group | Polyclonal Antibodies |
| Alternative Names | FLJ31614, RAB45 |
| Categoria | Polyclonal |
| Host | RABBIT |
| UniProt ID | Q8IZ41 |
| HTS Code | 3002150000 |
| Gene ID | 158158 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | IHC |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human RASEF, Gene description: RAS and EF-hand domain containing, Alternative Gene Names: FLJ31614, RAB45, Validated applications: IHC, Uniprot ID: Q8IZ41, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF