Anti-BDP1 Ver mas grande

Anti-BDP1 Antibody 100ul

AN-HPA077984-100ul

Producto nuevo

Anti-BDP1

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 100ul
Gene Name BDP1
Gene Description B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence YAINESQRPPDRSKMTMRDFIYYLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSII
Immunogen YAINESQRPPDRSKMTMRDFIYYLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSII
Product Group Polyclonal Antibodies
Alternative Names HSA238520, KIAA1241, KIAA1689, TAF3B1, TFC5, TFIIIB150, TFIIIB90, TFNR
Categoria Polyclonal
Host RABBIT
UniProt ID A6H8Y1
HTS Code 3002150000
Gene ID 55814
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación ICC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human BDP1, Gene description: B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB, Alternative Gene Names: HSA238520, KIAA1241, KIAA1689, TAF3B1, TFC5, TFIIIB150, TFIIIB90, TFNR, Validated applications: ICC, Uniprot ID: A6H8Y1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image