Ver mas grande
Anti-MUC15 Antibody 100ul
AN-HPA073304-100ul
Producto nuevo
Anti-MUC15
No hay Biopuntos para este producto
Hoja técnica
| Size | 100ul |
| Gene Name | MUC15 |
| Gene Description | mucin 15, cell surface associated |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | IHC |
| Sequence | SHRRLYDDRNEPVLRLDNAPEPYDVSFGNSSYYNPTLNDSAMPESEENARDGIPMDDIPPLRTSV |
| Immunogen | SHRRLYDDRNEPVLRLDNAPEPYDVSFGNSSYYNPTLNDSAMPESEENARDGIPMDDIPPLRTSV |
| Product Group | Polyclonal Antibodies |
| Categoria | Polyclonal |
| Host | RABBIT |
| UniProt ID | Q8N387 |
| HTS Code | 3002150000 |
| Gene ID | 143662 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | IHC |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human MUC15, Gene description: mucin 15, cell surface associated, Validated applications: IHC, Uniprot ID: Q8N387, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF