AN-HPA073187-25ul
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 25ul |
Gene Name | HLA-DQB2 |
Gene Description | major histocompatibility complex, class II, DQ beta 2 |
Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Shipping Conditions | Normally shipped at ambient temperature |
Species Reactivity Cross | Human |
Applications | IHC |
Sequence | GRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTIS |
Immunogen | GRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTIS |
Product Group | Polyclonal Antibodies |
Alternative Names | HLA-DXB |
Categoria | Polyclonal |
Host | RABBIT |
UniProt ID | P05538 |
HTS Code | 3002150000 |
Gene ID | 3120 |
Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purification | Affinity purified using the PrEST antigen as affinity ligand |
Iso type | IgG |
Aplicación | IHC |
Conjugation | Unconjugated |