Anti-WDFY2 Ver mas grande

Anti-WDFY2 Antibody 25ul

AN-HPA050094-25ul

Producto nuevo

Anti-WDFY2

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 25ul
Gene Name WDFY2
Gene Description WD repeat and FYVE domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence VCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDM
Immunogen VCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDM
Product Group Polyclonal Antibodies
Alternative Names ZFYVE22
Categoria Polyclonal
Host RABBIT
UniProt ID Q96P53
HTS Code 3002150000
Gene ID 115825
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación ICC, WB
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human WDFY2, Gene description: WD repeat and FYVE domain containing 2, Alternative Gene Names: ZFYVE22, Validated applications: ICC, WB, Uniprot ID: Q96P53, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image