Ver mas grande
Anti-AKAP7 Antibody 25ul
AN-HPA027200-25ul
Producto nuevo
Anti-AKAP7
No hay Biopuntos para este producto
Hoja técnica
| Size | 25ul |
| Gene Name | AKAP7 |
| Gene Description | A-kinase anchoring protein 7 |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | ICC |
| Sequence | AKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGD |
| Immunogen | AKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGD |
| Product Group | Polyclonal Antibodies |
| Alternative Names | AKAP15, AKAP18 |
| Categoria | Polyclonal |
| Host | RABBIT |
| UniProt ID | Q9P0M2 |
| HTS Code | 3002150000 |
| Gene ID | 9465 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | ICC |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human AKAP7, Gene description: A-kinase anchoring protein 7, Alternative Gene Names: AKAP15, AKAP18, Validated applications: ICC, Uniprot ID: Q9P0M2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF