Ver mas grande
Anti-MARCH6 Antibody 25ul
AN-HPA063246-25ul
Producto nuevo
Anti-MARCH6
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 25ul |
| Gene Name | MARCH6 |
| Gene Description | membrane-associated ring finger (C3HC4) 6, E3 ubiquitin protein ligase |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | IHC |
| Sequence | GAPIWLEHAAPPFNAAGHHQNEAPAGGNGAENVAADQPANPPAENAVVGENPDAQDDQAEEE |
| Immunogen | GAPIWLEHAAPPFNAAGHHQNEAPAGGNGAENVAADQPANPPAENAVVGENPDAQDDQAEEE |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | MARCH-VI, RNF176, TEB4 |
| Categoria | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | O60337 |
| HTS Code | 3002150000 |
| Gene ID | 10299 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | IHC |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human MARCH6, Gene description: membrane-associated ring finger (C3HC4) 6, E3 ubiquitin protein ligase, Alternative Gene Names: MARCH-VI, RNF176, TEB4, Validated applications: IHC, Uniprot ID: O60337, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF