Ver mas grande
Anti-HN1 Antibody 100ul
AN-HPA059729-100ul
Producto nuevo
Anti-HN1
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 100ul |
| Gene Name | HN1 |
| Gene Description | hematological and neurological expressed 1 |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | ICC, WB |
| Sequence | MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKS |
| Immunogen | MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKS |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | ARM2, HN1A |
| Categoria | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | Q9UK76 |
| HTS Code | 3002150000 |
| Gene ID | 51155 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | WB, ICC |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human HN1, Gene description: hematological and neurological expressed 1, Alternative Gene Names: ARM2, HN1A, Validated applications: ICC, WB, Uniprot ID: Q9UK76, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF