ADPGK,ADP-GK Ver mas grande

Anti-ADPGK Antibody 100ul

AN-HPA058525-100ul

Producto nuevo

Anti-ADPGK

Más detalles

Por favor regístrese para ver el precio

No hay Biopuntos para este producto


Añadir a Mis Favoritos

Hoja técnica

Size 100ul
Gene Name ADPGK
Gene Description ADP-dependent glucokinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SPGNGKDHSILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLC
Immunogen SPGNGKDHSILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ADP-GK, DKFZp434B195
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BRR6
HTS Code 3002150000
Gene ID 83440
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación ICC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human ADPGK, Gene description: ADP-dependent glucokinase, Alternative Gene Names: ADP-GK, DKFZp434B195, Validated applications: ICC, Uniprot ID: Q9BRR6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image