Ver mas grande
Anti-ABHD14A Antibody 100ul
AN-HPA056913-100ul
Producto nuevo
Anti-ABHD14A
No hay Biopuntos para este producto
Hoja técnica
| Size | 100ul |
| Gene Name | ABHD14A |
| Gene Description | abhydrolase domain containing 14A |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | ICC |
| Sequence | NYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP |
| Immunogen | NYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | DKFZP564O243, DORZ1 |
| Categoria | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | Q9BUJ0 |
| HTS Code | 3002150000 |
| Gene ID | 25864 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | ICC |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human ABHD14A, Gene description: abhydrolase domain containing 14A, Alternative Gene Names: DKFZP564O243, DORZ1, Validated applications: ICC, Uniprot ID: Q9BUJ0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF