Ver mas grande
Anti-DDHD1 Antibody 25ul
AN-HPA049870-25ul
Producto nuevo
Anti-DDHD1
No hay Biopuntos para este producto
Hoja técnica
| Size | 25ul |
| Gene Name | DDHD1 |
| Gene Description | DDHD domain containing 1 |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | WB, IHC |
| Sequence | NTAMMREAARKIEERHFSNHATHVEFLPVEWRSKLTLDGDTVDSITPDKVRGLRDMLNSSAMDIMYYTSPLYRDELVKGLQQELNRLYSLFCSRNPD |
| Immunogen | NTAMMREAARKIEERHFSNHATHVEFLPVEWRSKLTLDGDTVDSITPDKVRGLRDMLNSSAMDIMYYTSPLYRDELVKGLQQELNRLYSLFCSRNPD |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | KIAA1705, PA-PLA1, SPG28 |
| Categoria | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | Q8NEL9 |
| HTS Code | 3002150000 |
| Gene ID | 80821 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | IHC, WB |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human DDHD1, Gene description: DDHD domain containing 1, Alternative Gene Names: KIAA1705, PA-PLA1, SPG28, Validated applications: IHC, WB, Uniprot ID: Q8NEL9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF