Ver mas grande
Anti-RAD51C Antibody 100ul
AN-HPA045198-100ul
Producto nuevo
Anti-RAD51C
No hay Biopuntos para este producto
Hoja técnica
| Size | 100ul |
| Gene Name | RAD51C |
| Gene Description | RAD51 paralog C |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | ICC |
| Sequence | MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVG |
| Immunogen | MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVG |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | FANCO, RAD51L2 |
| Categoria | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | O43502 |
| HTS Code | 3002150000 |
| Gene ID | 5889 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | ICC |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human RAD51C, Gene description: RAD51 paralog C, Alternative Gene Names: FANCO, RAD51L2, Validated applications: ICC, Uniprot ID: O43502, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF