SEPT9,AF17q25 Ver mas grande

Anti-SEPT9 Antibody 100ul

AN-HPA042564-100ul

Producto nuevo

Anti-SEPT9

Más detalles

Por favor regístrese para ver el precio

No hay Biopuntos para este producto


Añadir a Mis Favoritos

Hoja técnica

Size 100ul
Gene Name SEPT9
Gene Description septin 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTPEPAPRRTEITIVKPQESA
Immunogen LGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTPEPAPRRTEITIVKPQESA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AF17q25, KIAA0991, MSF, MSF1, PNUTL4, SeptD1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UHD8
HTS Code 3002150000
Gene ID 10801
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación ICC, IHC, WB
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human SEPT9, Gene description: septin 9, Alternative Gene Names: AF17q25, KIAA0991, MSF, MSF1, PNUTL4, SeptD1, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UHD8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image