Ver mas grande
Anti-HSD17B2 Antibody 100ul
AN-HPA021826-100ul
Producto nuevo
Anti-HSD17B2
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 100ul |
| Gene Name | HSD17B2 |
| Gene Description | hydroxysteroid (17-beta) dehydrogenase 2 |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | ICC, IHC, WB |
| Sequence | AVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVL |
| Immunogen | AVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVL |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | HSD17, SDR9C2 |
| Categoria | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | P37059 |
| HTS Code | 3002150000 |
| Gene ID | 3294 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | ICC, IHC, WB |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human HSD17B2, Gene description: hydroxysteroid (17-beta) dehydrogenase 2, Alternative Gene Names: HSD17, SDR9C2, Validated applications: ICC, IHC, WB, Uniprot ID: P37059, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF