CANT1,SCAN-1,SHAPY Ver mas grande

Anti-CANT1 Antibody 100ul

AN-HPA019639-100ul

Producto nuevo

Anti-CANT1

Más detalles

Por favor regístrese para ver el precio

No hay Biopuntos para este producto


Añadir a Mis Favoritos

Hoja técnica

Size 100ul
Gene Name CANT1
Gene Description calcium activated nucleotidase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVK
Immunogen QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SCAN-1, SHAPY
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WVQ1
HTS Code 3002150000
Gene ID 124583
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación WB, IHC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human CANT1, Gene description: calcium activated nucleotidase 1, Alternative Gene Names: SCAN-1, SHAPY, Validated applications: IHC, WB, Uniprot ID: Q8WVQ1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image