Ver mas grande
CR2 polyclonal antibody
AB-PAB30297
Producto nuevo
CR2 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | CR2 |
| Gene Alias | C3DR|CD21|SLEB9 |
| Gene Description | complement component (3d/Epstein Barr virus) receptor 2 |
| Storage Conditions | Store at 4ºC for short term storage. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,IHC-P |
| Immunogen Prot. Seq | VIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKS |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)<br>Western Blot (1:250 - 1:500)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids 46-129 of human CR2. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Gene ID | 1380 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against partial recombinant human CR2.