Ver mas grande
GSX2 polyclonal antibody
AB-PAB30113
Producto nuevo
GSX2 polyclonal antibody
No hay Biopuntos para este producto
Hoja técnica
| Size | 100 uL |
| Gene Name | GSX2 |
| Gene Alias | GSH2 |
| Gene Description | GS homeobox 2 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,IHC-P |
| Immunogen Prot. Seq | MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGC |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)<br>Western Blot<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | A synthetic peptide corresponding to N-terminus of human GSX2. |
| Storage Buffer | In PBS (2% sucrose, 0.09% sodium azide). |
| Gene ID | 170825 |
Más información
Rabbit polyclonal antibody raised against synthetic peptide of human GSX2.