Ver mas grande
CRELD1 polyclonal antibody
AB-PAB30011
Producto nuevo
CRELD1 polyclonal antibody
No hay Biopuntos para este producto
Hoja técnica
| Size | 100 uL |
| Gene Name | CRELD1 |
| Gene Alias | AVSD2|CIRRIN|DKFZp566D213 |
| Gene Description | cysteine-rich with EGF-like domains 1 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,IHC-P |
| Immunogen Prot. Seq | TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)<br>Western Blot (5 ug/mL)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | A synthetic peptide corresponding to C-terminus of human CRELD1. |
| Storage Buffer | In PBS (2% sucrose, 0.09% sodium azide). |
| Gene ID | 78987 |
Más información
Rabbit polyclonal antibody raised against synthetic peptide of human CRELD1.