Ver mas grande
UBA1 polyclonal antibody
AB-PAB29508
Producto nuevo
UBA1 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | UBA1 |
| Gene Alias | A1S9|A1S9T|A1ST|AMCX1|GXP1|MGC4781|SMAX2|UBA1A|UBE1|UBE1X |
| Gene Description | ubiquitin-like modifier activating enzyme 1 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,IHC-P |
| Immunogen Prot. Seq | LAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVP |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:50-1:200)<br>Western Blot (1:100-1:250)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to human UBA1. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 7317 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant human UBA1.