Ver mas grande
SULT4A1 polyclonal antibody
AB-PAB28739
Producto nuevo
SULT4A1 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | SULT4A1 |
| Gene Alias | BR-STL-1|BRSTL1|DJ388M5.3|MGC40032|NST|SULTX3|hBR-STL-1 |
| Gene Description | sulfotransferase family 4A, member 1 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IHC |
| Immunogen Prot. Seq | GEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSL |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:10-1:20)<br> Western Blot (1:100-1:250 )<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human SULT4A1. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Gene ID | 25830 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant SULT4A1.