Ver mas grande
C14orf100 polyclonal antibody
AB-PAB28315
Producto nuevo
C14orf100 polyclonal antibody
No hay Biopuntos para este producto
Hoja técnica
| Size | 100 uL |
| Gene Name | C14orf100 |
| Gene Alias | CDA06|HSPC213|HSPC327|JAMP |
| Gene Description | chromosome 14 open reading frame 100 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IHC-P |
| Immunogen Prot. Seq | LYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTH |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:10-1:20)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of recombinant C14orf100. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 51528 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant C14orf100.