Ver mas grande
FAM103A1 polyclonal antibody
AB-PAB23881
Producto nuevo
FAM103A1 polyclonal antibody
No hay Biopuntos para este producto
Hoja técnica
| Size | 100 uL |
| Gene Name | FAM103A1 |
| Gene Alias | C15orf18|HsT19360|MGC102778|MGC2560 |
| Gene Description | family with sequence similarity 103, member A1 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,IHC-P |
| Immunogen Prot. Seq | MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQ |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:1000-1:2500)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human FAM103A1. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 83640 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant FAM103A1.