SAMD12 polyclonal antibody Ver mas grande

SAMD12 polyclonal antibody

AB-PAB21726

Producto nuevo

SAMD12 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name SAMD12
Gene Alias FLJ39458|MGC148139|MGC148140
Gene Description sterile alpha motif domain containing 12
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LHCGLNPRGIDHPAHAEGIKLQIEGEGVESQSIKNKNFQKVPDQKGTPKRLQAEAETAKSATVKLSKPVALWTQQDVCKWLKKHCPNQYQIYSESF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SAMD12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 401474
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant SAMD12.

Consulta sobre un producto

SAMD12 polyclonal antibody

SAMD12 polyclonal antibody