OTUD6B polyclonal antibody Ver mas grande

OTUD6B polyclonal antibody

AB-PAB21703

Producto nuevo

OTUD6B polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name OTUD6B
Gene Alias CGI-77|DUBA5
Gene Description OTU domain containing 6B
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq HCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OTUD6B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51633
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant OTUD6B.

Consulta sobre un producto

OTUD6B polyclonal antibody

OTUD6B polyclonal antibody