AB-PAB21699
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Size | 100 uL |
Gene Name | CHMP6 |
Gene Alias | FLJ11749|VPS20 |
Gene Description | chromatin modifying protein 6 |
Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Tr,IHC-P |
Immunogen Prot. Seq | QFGNECLNKMHQVMSIEEVERILDETQEAVEYQRQIDELLAGSFTQEDEDAILEELSAITQEQIELPEVPSEPLPEKIPENVPVK |
Form | Liquid |
Recomended Dilution | Immunohistochemistry (1:1000-1:2500)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Immunogen | Recombinant protein corresponding to amino acids of human CHMP6. |
Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Gene ID | 79643 |
Iso type | IgG |