Ver mas grande
LOC541473 purified MaxPab rabbit polyclonal antibody (D01P)
AB-H00541473-D01P
Producto nuevo
LOC541473 purified MaxPab rabbit polyclonal antibody (D01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | LOC541473 |
| Gene Alias | MGC88170 |
| Gene Description | FK506 binding protein 6, 36kDa pseudogene |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,IF |
| Immunogen Prot. Seq | MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYYGYLEHLDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMQRGELARCFVLGKLLDSQGPSLHLYLRAS |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | LOC541473 (NP_001013770.1, 1 a.a. ~ 131 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 541473 |
Más información
Rabbit polyclonal antibody raised against a full-length human LOC541473 protein.