AB-H00541473-D01P
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 100 ug |
Gene Name | LOC541473 |
Gene Alias | MGC88170 |
Gene Description | FK506 binding protein 6, 36kDa pseudogene |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ce,WB-Tr,IF |
Immunogen Prot. Seq | MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYYGYLEHLDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMQRGELARCFVLGKLLDSQGPSLHLYLRAS |
Antigen species Target species | Human |
Quality control testing | Antibody reactive against mammalian transfected lysate. |
Immunogen | LOC541473 (NP_001013770.1, 1 a.a. ~ 131 a.a) full-length human protein. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 541473 |