Ver mas grande
Mouse monoclonal antibody raised against a full-length recombinant BOLA3.
AB-H00388962-M05
Producto nuevo
BOLA3 monoclonal antibody (M05), clone 1D12
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | BOLA3 |
| Gene Alias | - |
| Gene Description | bolA homolog 3 (E. coli) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MAAWSPAAAAPLLRGIRGLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIE |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | BOLA3 (AAH42036.1, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 388962 |
| Clone Number | 1D12 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a full-length recombinant BOLA3.