Ver mas grande
OR52B2 MaxPab mouse polyclonal antibody (B01P)
AB-H00255725-B01P
Producto nuevo
OR52B2 MaxPab mouse polyclonal antibody (B01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | OR52B2 |
| Gene Alias | OR11-70 |
| Gene Description | olfactory receptor, family 52, subfamily B, member 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MSHTNVTIFHPAVFVLPGIPGLEAYHIWLSIPLCLIYITAVLGNSILIVVIVMERNLHVPMYFFLSMLAVMDILLSTTTVPKALAIFWLQAHNIAFDACVTQGFFVHMMFVGESAILLAMAFDRFVAICAPLRYTTVLTWPVVGRIALAVITRSFCIIFPVIFLLKRLPFCLTNIVPHSYCEHIGVARLACADITVNIWYGFSVPIVMVILDVILIAVSYSLILRAVFRLPSQDARHKALSTCGSHLCVILMFYV |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | OR52B2 (NP_001004052.1, 1 a.a. ~ 323 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 255725 |
Más información
Mouse polyclonal antibody raised against a full-length human OR52B2 protein.