Ver mas grande
ATP6V1C2 MaxPab rabbit polyclonal antibody (D01)
AB-H00245973-D01
Producto nuevo
ATP6V1C2 MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | ATP6V1C2 |
| Gene Alias | ATP6C2|VMA5 |
| Gene Description | ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IP |
| Immunogen Prot. Seq | MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYDTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEK |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | ATP6V1C2 (AAH12142.1, 1 a.a. ~ 381 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 245973 |
Más información
Rabbit polyclonal antibody raised against a full-length human ATP6V1C2 protein.