FOXQ1 monoclonal antibody (M07), clone 4H8 Ver mas grande

FOXQ1 monoclonal antibody (M07), clone 4H8

AB-H00094234-M07

Producto nuevo

FOXQ1 monoclonal antibody (M07), clone 4H8

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name FOXQ1
Gene Alias HFH1
Gene Description forkhead box Q1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FOXQ1 (NP_150285, 110 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 94234
Clone Number 4H8
Iso type IgG2b Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant FOXQ1.

Consulta sobre un producto

FOXQ1 monoclonal antibody (M07), clone 4H8

FOXQ1 monoclonal antibody (M07), clone 4H8