Ver mas grande
Mouse polyclonal antibody raised against a full-length human GADD45GIP1 protein.
AB-H00090480-B01P
Producto nuevo
GADD45GIP1 purified MaxPab mouse polyclonal antibody (B01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | GADD45GIP1 |
| Gene Alias | CKBBP2|CRIF1|MGC4667|MGC4758|PLINP-1|PRG6|Plinp1 |
| Gene Description | growth arrest and DNA-damage-inducible, gamma interacting protein 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr |
| Immunogen Prot. Seq | MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | GADD45GIP1 (NP_443082, 1 a.a. ~ 222 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 90480 |
Más información
Mouse polyclonal antibody raised against a full-length human GADD45GIP1 protein.