Ver mas grande
SYT16 purified MaxPab mouse polyclonal antibody (B01P)
AB-H00083851-B01P
Producto nuevo
SYT16 purified MaxPab mouse polyclonal antibody (B01P)
No hay Biopuntos para este producto
Hoja técnica
| Size | 50 ug |
| Gene Name | SYT16 |
| Gene Alias | CHR14SYT|SYT14L|Strep14|syt14r|yt14r |
| Gene Description | synaptotagmin XVI |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr |
| Immunogen Prot. Seq | MTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVSHSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKETKGQQICRWHTLLES |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | SYT16 (AAH40924.1, 1 a.a. ~ 203 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 83851 |
Más información
Mouse polyclonal antibody raised against a full-length human SYT16 protein.