Ver mas grande
POLE3 polyclonal antibody (A01)
AB-H00054107-A01
Producto nuevo
POLE3 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | POLE3 |
| Gene Alias | CHARAC17|CHRAC17|YBL1|p17 |
| Gene Description | polymerase (DNA directed), epsilon 3 (p17 subunit) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | POLE3 (AAH03166, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 54107 |
Más información
Mouse polyclonal antibody raised against a full-length recombinant POLE3.