Ver mas grande
TH1L monoclonal antibody (M01A), clone 3C9
AB-H00051497-M01A
Producto nuevo
TH1L monoclonal antibody (M01A), clone 3C9
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 200 uL |
| Gene Name | TH1L |
| Gene Alias | HSPC130|NELF-C|NELF-D|TH1 |
| Gene Description | TH1-like (Drosophila) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA |
| Immunogen Prot. Seq | ELKKTLLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPYTSDFVQLFLPILENDSIAGTIKTEGEHDPVTEFIAHCKSNFIMVN |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | TH1L (NP_057481.2, 491 a.a. ~ 590 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 51497 |
| Clone Number | 3C9 |
| Iso type | IgM Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant TH1L.