Ver mas grande
MAT2B polyclonal antibody (A01)
AB-H00027430-A01
Producto nuevo
MAT2B polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | MAT2B |
| Gene Alias | MAT-II|MATIIbeta|MGC12237|Nbla02999|SDR23E1|TGR |
| Gene Description | methionine adenosyltransferase II, beta |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MPEMPEDMEQEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIA |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MAT2B (AAH05218, 1 a.a. ~ 323 a.a) full-length recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 27430 |
Más información
Mouse polyclonal antibody raised against a full-length recombinant MAT2B.