AB-H00027242-M48
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 100 ug |
Gene Name | TNFRSF21 |
Gene Alias | BM-018|DR6|MGC31965 |
Gene Description | tumor necrosis factor receptor superfamily, member 21 |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | ELISA |
Immunogen Prot. Seq | ASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTL |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | TNFRSF21 (AAH17730.1, 47 a.a. ~ 214 a.a) partial recombinant protein. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 27242 |
Clone Number | 4D8 |
Iso type | IgG1 Kappa |