Ver mas grande
Mouse polyclonal antibody raised against a partial recombinant PDE7B.
AB-H00027115-A01
Producto nuevo
PDE7B polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | PDE7B |
| Gene Alias | MGC88256|bA472E5.1 |
| Gene Description | phosphodiesterase 7B |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MSCLMVERCGEILFENPDQNAKCVCMLGDIRLRGQTGVRAERRGSYPFIDFRLLNSTTYSGEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLDED |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PDE7B (NP_061818, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 27115 |
Más información
Mouse polyclonal antibody raised against a partial recombinant PDE7B.