Ver mas grande
FGFR1OP2 polyclonal antibody (A01)
AB-H00026127-A01
Producto nuevo
FGFR1OP2 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | FGFR1OP2 |
| Gene Alias | DKFZp564O1863|HSPC123-like |
| Gene Description | FGFR1 oncogene partner 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | RSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDPGIIMKLKEQHSKIDMVHRNKSEGFFLDASRHILEAPQHGLERRHLEANQ |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | FGFR1OP2 (NP_056448, 62 a.a. ~ 169 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 26127 |
Más información
Mouse polyclonal antibody raised against a partial recombinant FGFR1OP2.