Ver mas grande
RASGRP3 MaxPab rabbit polyclonal antibody (D01)
AB-H00025780-D01
Producto nuevo
RASGRP3 MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | RASGRP3 |
| Gene Alias | GRP3|KIAA0846 |
| Gene Description | RAS guanyl releasing protein 3 (calcium and DAG-regulated) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Tr,IP,IF |
| Immunogen Prot. Seq | MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNTLMAVVGGLSHSSISR |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | RASGRP3 (NP_733772.1, 1 a.a. ~ 690 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 25780 |
Más información
Rabbit polyclonal antibody raised against a full-length human RASGRP3 protein.