AB-H00025780-D01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 100 uL |
Gene Name | RASGRP3 |
Gene Alias | GRP3|KIAA0846 |
Gene Description | RAS guanyl releasing protein 3 (calcium and DAG-regulated) |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ti,WB-Tr,IP,IF |
Immunogen Prot. Seq | MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNTLMAVVGGLSHSSISR |
Antigen species Target species | Human |
Quality control testing | Antibody reactive against mammalian transfected lysate. |
Immunogen | RASGRP3 (NP_733772.1, 1 a.a. ~ 690 a.a) full-length human protein. |
Storage Buffer | No additive |
Gene ID | 25780 |