NAT6 purified MaxPab rabbit polyclonal antibody (D01P) Ver mas grande

NAT6 purified MaxPab rabbit polyclonal antibody (D01P)

AB-H00024142-D01P

Producto nuevo

NAT6 purified MaxPab rabbit polyclonal antibody (D01P)

Más detalles

Por favor regístrese para ver el precio

No hay Biopuntos para este producto


Hoja técnica

Size 100 ug
Gene Name NAT6
Gene Alias FUS-2|FUS2
Gene Description N-acetyltransferase 6 (GCN5-related)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NAT6 (NP_036323.2, 1 a.a. ~ 308 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 24142

Más información

Rabbit polyclonal antibody raised against a full-length human NAT6 protein.

Consulta sobre un producto

NAT6 purified MaxPab rabbit polyclonal antibody (D01P)

NAT6 purified MaxPab rabbit polyclonal antibody (D01P)