Ver mas grande
Mouse polyclonal antibody raised against a partial recombinant SSBP3.
AB-H00023648-A01
Producto nuevo
SSBP3 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | SSBP3 |
| Gene Alias | CSDP|FLJ10355|SSDP|SSDP1 |
| Gene Description | single stranded DNA binding protein 3 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SSBP3 (NP_060540, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 23648 |
Más información
Mouse polyclonal antibody raised against a partial recombinant SSBP3.