Ver mas grande
EDC4 MaxPab mouse polyclonal antibody (B01)
AB-H00023644-B01
Producto nuevo
EDC4 MaxPab mouse polyclonal antibody (B01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | EDC4 |
| Gene Alias | Ge-1|HEDLS|RCD-8 |
| Gene Description | enhancer of mRNA decapping 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MASCASIDIEDATQHLRDILKLDRPAGGPSAESPRPSSAYNGDLNGLLVPDPLCSGDSTSANKTGLRTMPPINLQEKQVICLSGDDSSTCIGILAKEVEIVASSDSSISSKARGSNKVKIQPVAKYDWEQKYYYGNLIAVSNSFLAYAIRAANNGSAMVRVISVSTSERTLLKGFTGSVADLAFAHLNSPQLACLDEAGNLFVWRLALVNGKIQEEILVHIRQPEGTPLNHFRRIIWCPFIPEESEDCCEESSPT |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | EDC4 (NP_055144.3, 1 a.a. ~ 1401 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 23644 |
Más información
Mouse polyclonal antibody raised against a full-length human EDC4 protein.