Ver mas grande
CLASP2 monoclonal antibody (M01), clone 3E9
AB-H00023122-M01
Producto nuevo
CLASP2 monoclonal antibody (M01), clone 3E9
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CLASP2 |
| Gene Alias | - |
| Gene Description | cytoplasmic linker associated protein 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MRRLICKRICDYKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGAVDEDDFIKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLE |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CLASP2 (AAH29035.1, 1 a.a. ~ 431 a.a) full-length recombinant protein with GST-pstS1 tag. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 23122 |
| Clone Number | 3E9 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a full-length recombinant CLASP2.