Ver mas grande
SUGT1 monoclonal antibody (M03), clone 6G5
AB-H00010910-M03
Producto nuevo
SUGT1 monoclonal antibody (M03), clone 6G5
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | SUGT1 |
| Gene Alias | SGT1 |
| Gene Description | SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | VVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVG |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SUGT1 (NP_006695, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 10910 |
| Clone Number | 6G5 |
| Iso type | IgG3 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant SUGT1.